PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G212600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 314aa    MW: 33878.3 Da    PI: 8.3785
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G212600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53e-181562148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++l+  ++q+G g+W++ +++ g++R++k+c++rw +yl
  Sevir.1G212600.1.p 15 KGPWTPEEDQKLLAFIEQHGHGCWRSLPAKAGLRRCGKSCRLRWTNYL 62
                        79********************************************97 PP

2Myb_DNA-binding54.72.4e-1768113148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Sevir.1G212600.1.p  68 RGKFTLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 113
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.8E-25765IPR009057Homeodomain-like
PROSITE profilePS5129418.591062IPR017930Myb domain
SuperFamilySSF466893.52E-3012109IPR009057Homeodomain-like
SMARTSM007172.5E-151464IPR001005SANT/Myb domain
PfamPF002491.9E-161562IPR001005SANT/Myb domain
CDDcd001672.73E-121762No hitNo description
PROSITE profilePS5129426.33363117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2666117IPR009057Homeodomain-like
SMARTSM007175.8E-1767115IPR001005SANT/Myb domain
PfamPF002491.5E-1668113IPR001005SANT/Myb domain
CDDcd001672.75E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGRSPCCEKE ARLKKGPWTP EEDQKLLAFI EQHGHGCWRS LPAKAGLRRC GKSCRLRWTN  60
YLRPDIKRGK FTLQEEQTII QLHALLGNRW SAIATHLPKR TDNEIKNYWN THLKKRLAKM  120
GIDPVTHKPR ADAPGATASG ARYRAAAHLS HTAQWESARL EAEARLAREA KLRALASPPP  180
PPASAPAASG LESPTSTLSF SEGAMFAGAA HDDVPGAARA PVVLTPRSYG EAFGEHGDAP  240
GFLAGVLLDC SVAGAEQRFA AASTDASVGE QQEEEDKGYW SSILNMVNSS MSSSLTSEAV  300
TDPAMYLPAV PEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0853910.0BT085391.2 Zea mays full-length cDNA clone ZM_BFc0006G19 mRNA, complete cds.
GenBankBT0863810.0BT086381.2 Zea mays full-length cDNA clone ZM_BFc0159P01 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952890.10.0PREDICTED: myb-related protein Zm38-like
TrEMBLK3YUA50.0K3YUA5_SETIT; Uncharacterized protein
STRINGSi017851m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.18e-89myb domain protein 16